Protein Info for PFLU_RS13395 in Pseudomonas fluorescens SBW25

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 73 to 97 (25 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 212 to 218 (7 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 91 to 264 (174 residues), 58.7 bits, see alignment E=3.4e-20

Best Hits

KEGG orthology group: K10229, sorbitol/mannitol transport system permease protein (inferred from 100% identity to pfs:PFLU2743)

MetaCyc: 94% identical to polyol ABC-type transporter permease component MtlG (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, permease component 2" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KAV1 at UniProt or InterPro

Protein Sequence (276 amino acids)

>PFLU_RS13395 carbohydrate ABC transporter permease (Pseudomonas fluorescens SBW25)
MTLQQSRRLQSLLLGTLAWAIAILIFFPIFWMVLTSFKTEIDAFATPPQFIFTPTLENYL
HINERSNYFSYAWNSVLISFSATALCLLISVPAAYSMAFYETQRTKGTLLWMLSTKMLPP
VGVLMPIYLLAKSFGLLDTRIALIIIYTLINLPIVVWMVYTYFKDIPKDILEAARLDGAT
LWQEMVRVLLPIAKGGLASTVLLSLILCWNEAFWSLNLTSSTAAPLTALIASYSSPEGLF
WAKLSAVSTLACAPILIFGWISQKQLVRGLSFGAVK