Protein Info for PFLU_RS13385 in Pseudomonas fluorescens SBW25

Annotation: mannitol dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 PF01232: Mannitol_dh" amino acids 28 to 192 (165 residues), 167.4 bits, see alignment E=2.8e-53 PF08125: Mannitol_dh_C" amino acids 221 to 460 (240 residues), 256.5 bits, see alignment E=2.7e-80

Best Hits

Swiss-Prot: 47% identical to M2DH_ASPFC: Mannitol 2-dehydrogenase (AFUB_071700) from Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163)

KEGG orthology group: K00045, mannitol 2-dehydrogenase [EC: 1.1.1.67] (inferred from 100% identity to pfs:PFLU2741)

Predicted SEED Role

"Multiple polyol-specific dehydrogenase (EC 1.1.1.-)" in subsystem Mannitol Utilization or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.- or 1.1.1.67

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KAU9 at UniProt or InterPro

Protein Sequence (493 amino acids)

>PFLU_RS13385 mannitol dehydrogenase family protein (Pseudomonas fluorescens SBW25)
MKLNKHTLTQLAPEVKLPAYAIASTTQGIAHIGVGGFHRAHQAYYTDALMNTGEGLDWSI
CGVGLRAEDRKARDDLAGQDYLFTLYELGDTDDTEVRVIGSISDMLLAEDGAQALIDKLA
SPAIRIVSLTITEGGYCIDDSNGEFMAHLPQIQHDLAHPSAPKTVFGFICAALTQRRANG
IPAFTVMSCDNLPHNGAVTRKALLAFAALHNAELHDWIKANVSFPNAMVDRITPMTSTAH
RQQLHDEHAIDDAWPVVCEPFVQWVLEDTFVNGRPAWEKVGVQFTHDVTPYEEMKIGLLN
GSHLALTYLGFLKGYRFVHETMNDPVFVAYMRAYMDLDVTPNLAPVPGIDLTEYKQTLVD
RFSNQAIADQLERVCSDGSSKFPKFTVPTINRLIADGRETERAALVVAAWALYLKGVDEN
GVRYTIPDPRAAFCQGLVSDEALISKRLLGVEEIFGTAIPNSPEFVSAFERCYASLRDNG
VTKTLQQLLKKPA