Protein Info for PFLU_RS12800 in Pseudomonas fluorescens SBW25

Annotation: amino acid ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 26 to 183 (158 residues), 112.4 bits, E=2.7e-36

Best Hits

Swiss-Prot: 51% identical to NOCP_AGRFC: Nopaline permease ATP-binding protein P (nocP) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02028, polar amino acid transport system ATP-binding protein [EC: 3.6.3.21] (inferred from 100% identity to pfs:PFLU2620)

MetaCyc: 48% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"ABC-type polar amino acid transport system, ATPase component"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.21

Use Curated BLAST to search for 3.6.3.21 or 7.4.2.1

Sequence Analysis Tools

See C3K9M8 at UniProt or InterPro

Protein Sequence (260 amino acids)

>PFLU_RS12800 amino acid ABC transporter ATP-binding protein (Pseudomonas fluorescens SBW25)
MNQPHTNPPLLNIRGLRKQYGEVEVLKGVDLSMQRGNVVTLIGSSGSGKTTLLRCVNLLE
EFQGGQITLDGESIGYSEIAGKRVRHPERVIAQHRAMTGMAFQQFNLFPHLTALQNVTLG
LLKVKKMPKDEAVVLAEKWLDRVGLLERRNHFPGQLSGGQQQRVAIARAIAMNPSLMLFD
EVTSALDPELVGEVLSVIKGLAEEGMTMLLVTHEMRFAYEVSDKIVFMNQGRIEEQGTSK
DIFERPQSPRLAEFLKNIRF