Protein Info for PFLU_RS12510 in Pseudomonas fluorescens SBW25

Annotation: methionine gamma-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01328: methionine gamma-lyase
  • amino acids 9 to 396 (388 residues), 579 bits, E=2.2e-178
• PF01053: Cys_Met_Meta_PP
  • amino acids 12 to 395 (384 residues), 471.9 bits, E=1.8e-145
• PF06838: Met_gamma_lyase
  • amino acids 55 to 230 (176 residues), 31.9 bits, E=8.1e-12
• PF00155: Aminotran_1_2
  • amino acids 67 to 236 (170 residues), 37.4 bits, E=2.8e-13

Best Hits

Swiss-Prot: 78% identical to MEGL_PSEDM: L-methionine gamma-lyase (megL) from Pseudomonas deceptionensis

KEGG orthology group: K01761, methionine-gamma-lyase [EC: 4.4.1.11] (inferred from 100% identity to pfs:PFLU2558)

MetaCyc: 78% identical to methionine gamma-lyase (Pseudomonas deceptionensis)
Methionine gamma-lyase. [EC: 4.4.1.11]

Predicted SEED Role

"Methionine gamma-lyase (EC 4.4.1.11)" in subsystem Methionine Degradation (EC 4.4.1.11)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-methionine degradation II (3/3 steps found)
• seleno-amino acid detoxification and volatilization III (2/3 steps found)
• L-threonine degradation I (4/6 steps found)
• dimethyl sulfide biosynthesis from methionine (1/2 steps found)
• seleno-amino acid detoxification and volatilization I (1/2 steps found)
• superpathway of L-threonine metabolism (11/18 steps found)
• superpathway of seleno-compound metabolism (8/19 steps found)
• hypoglycin biosynthesis (4/14 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.11

Sequence Analysis Tools

See C3K9G7 at UniProt or InterPro

Protein Sequence (411 amino acids)

>PFLU_RS12510 methionine gamma-lyase (Pseudomonas fluorescens SBW25)
MNNKHNTFGFSTRAIHHGYDPKDHHGALVPPIYLSATFAFPTAEYGAACFAGEAAGHFYT
RISNPTLALLESRMATLENGEAAVAFSSGMGAIAATFWTLLRPGDEVIVSQTLYGCTFAL
LHHGIGEFGIKVRHVDLTDLAALQAALCPATRMIYCETPANPTLQLVDIAAVAALAHQQP
NVTVVIDNTYCTPYLQRPLDLGADVVVHSATKYLSGHGDITAGIAVSSQALAQRIRLQGL
KDLTGAVMSPQDASLLMRGLKTLALRMDRHCSNAQAVAEALQAHPAVQWVTYPGLRSFAQ
YELATRQMKLPGGMIAFELKGGIDTGRRFMNALTVFTRAVSLGDAESLAQHPASMTHSTY
TPEERAAHGISEGLVRLSVGLEDIADLLADVQQALAKCARTVTRPSKLVNI