Protein Info for PFLU_RS12225 in Pseudomonas fluorescens SBW25

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 TIGR00229: PAS domain S-box protein" amino acids 27 to 137 (111 residues), 49 bits, see alignment E=3.3e-17 amino acids 152 to 259 (108 residues), 49.1 bits, see alignment E=3e-17 PF13426: PAS_9" amino acids 32 to 134 (103 residues), 45.7 bits, see alignment E=1.7e-15 amino acids 160 to 256 (97 residues), 41.7 bits, see alignment E=3e-14 PF08448: PAS_4" amino acids 32 to 136 (105 residues), 41.2 bits, see alignment E=4.4e-14 amino acids 154 to 257 (104 residues), 39.7 bits, see alignment E=1.2e-13 PF08447: PAS_3" amino acids 44 to 128 (85 residues), 49.9 bits, see alignment E=8e-17 amino acids 165 to 250 (86 residues), 54.3 bits, see alignment E=3.4e-18 PF00989: PAS" amino acids 154 to 254 (101 residues), 23.8 bits, see alignment E=9.2e-09 PF00015: MCPsignal" amino acids 275 to 431 (157 residues), 136.2 bits, see alignment E=2.6e-43

Best Hits

Swiss-Prot: 52% identical to BDLA_PSEAE: Biofilm dispersion protein BdlA (bdlA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2498)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K8R5 at UniProt or InterPro

Protein Sequence (437 amino acids)

>PFLU_RS12225 methyl-accepting chemotaxis protein (Pseudomonas fluorescens SBW25)
MFNKALKRKLSDLEAKSSELNELFVALDRSTAIIEFNAEGNVASANNNFLRLFGYHADEI
LCKTHKDFCLASFGRSPEYPSFWQRLQLGESLSGTFPRITKNGEVIWIEATYSPLLGASG
KVEKIIKFAFDVTEQVARDSELRAKLNAIDRAMAIIEFDTCGNIICANQNFLNVVGYDVS
GLKGKHHSLFCEPELTRTEGYIDFWRRLNAGDFFSGQFKRIAKSGKTVWLEASYNPVYDR
DGKLIKIIKFASDITARIEKIGEDAQGASRAYHISAETERVAKQGAQVIHETAIEMRSIA
ESIGISARLVGELGDRSEQITAIVNTIRGIAEQTNLLALNAAIEAARAGDQGRGFAVVAD
EVRQLAGRTSRSTAEIAEMIGRILTETRDAVASMVSTRDRAQRGVMLADQAGEVISQIQR
GTSDAVEAVSMFASKCD