Protein Info for PFLU_RS11740 in Pseudomonas fluorescens SBW25

Annotation: NAD(P)-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 5 to 292 (288 residues), 230.2 bits, see alignment E=1.1e-71 PF00070: Pyr_redox" amino acids 143 to 213 (71 residues), 60.8 bits, see alignment E=4.4e-20 PF13450: NAD_binding_8" amino acids 146 to 180 (35 residues), 24.3 bits, see alignment 9.1e-09 PF14759: Reductase_C" amino acids 312 to 397 (86 residues), 43.8 bits, see alignment E=9e-15

Best Hits

KEGG orthology group: K00529, ferredoxin--NAD+ reductase [EC: 1.18.1.3] (inferred from 100% identity to pfs:PFLU2392)

Predicted SEED Role

"Ferredoxin reductase" in subsystem Anaerobic respiratory reductases

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.18.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K988 at UniProt or InterPro

Protein Sequence (399 amino acids)

>PFLU_RS11740 NAD(P)-binding protein (Pseudomonas fluorescens SBW25)
MSAPLIIVGAGHAGGRAALTLREEGYTGRLILIGDEPHLPYERPPLSKAVLQGTADLAGC
SLCDSARLTELGIEHIAGHPVTQLEPEHHRLQLADGQWLPYAGLLLATGGRARRLPQEQA
HVLYLRTHDEALALRNALKAGTRLVVVGGGFIGLEVAATARGLGCEVTLLEAGPRLAGRV
LPPVISEALLALHRQHGVDVRLNVALESIQADAVLLVDGQRLPCDLVVVGIGMQPNIELA
TAAGLDVGQGIRVDTHLRTSAPDIYAAGDVCEFRLGGLYQRQETWRNAEVQGRHAALNLL
GHDVPFDALPGFWSDQYDWGLQTVGVITPLTVSRPLAGGGVLLFYLDAEHHLHGACGWAP
GNSVAKDIKLCERLISARIPLNAASLADPELSLKHLLRG