Protein Info for PFLU_RS11480 in Pseudomonas fluorescens SBW25

Annotation: response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 PF00072: Response_reg" amino acids 7 to 116 (110 residues), 84.7 bits, see alignment E=5.2e-28 PF00196: GerE" amino acids 152 to 206 (55 residues), 67.2 bits, see alignment E=7.8e-23

Best Hits

Swiss-Prot: 42% identical to NARP_HAEIN: Nitrate/nitrite response regulator protein homolog (narP) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K07684, two-component system, NarL family, nitrate/nitrite response regulator NarL (inferred from 100% identity to pfs:PFLU2338)

Predicted SEED Role

"Nitrate/nitrite response regulator protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K8H7 at UniProt or InterPro

Protein Sequence (219 amino acids)

>PFLU_RS11480 response regulator (Pseudomonas fluorescens SBW25)
MDCTTLLLIDDHPLFRKGLAQLFDASGDFEVVGQAASGREGINLAVSLTPQQVLLDLHMP
GLSGLQVLDELRQLRLDCQVVVLTASPDRAELLTALRLGASGYVLKETEPDALLAYMRNC
HKGAIVLDSTLIALLADQAEPSPSCDPIDSGNLTEREGQTLALIAAGMSNKQIGRELGIS
DGTVKIYVRSLLQKLGLHSRLELAAWVHSGALMKHEERH