Protein Info for PFLU_RS11265 in Pseudomonas fluorescens SBW25

Annotation: pectate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF00544: Pectate_lyase_4" amino acids 58 to 240 (183 residues), 207.1 bits, see alignment E=1.2e-65

Best Hits

Swiss-Prot: 94% identical to PELD_PSEMA: Pectin lyase (pnl) from Pseudomonas marginalis

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2293)

Predicted SEED Role

"Pectin lyase (EC 4.2.2.10)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 4.2.2.10)

Isozymes

Compare fitness of predicted isozymes for: 4.2.2.10

Use Curated BLAST to search for 4.2.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K565 at UniProt or InterPro

Protein Sequence (312 amino acids)

>PFLU_RS11265 pectate lyase (Pseudomonas fluorescens SBW25)
MSYPESKLTGLIGFAQAAKVTGGWSGPVVSITTLDQLKANIGDTTPRVLVINSNISASSL
TKVNMGANKTLIGSFQNRTLENIHLRATAQSQNIILQNLIFKHSASIKANDDIQVYLNYG
SKYWIDHCSFVGHSWSTTDGSEDKLLYIGEKADYATISNCFFGSHKYGLIFGHPADDNKA
EFNGYPRLTLCHNRFDNMEVRAPGLMRYGYFHVYNNYINNFHLGFTLAQNANILSESNYF
GEGSQNKGMLDDKGTGTFTDTNSVPPITNQKSPKAQWTALSNYGYTLKTAAQAKDFTQKN
AGAQSVALIFGS