Protein Info for PFLU_RS11235 in Pseudomonas fluorescens SBW25

Annotation: LysR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 220 to 243 (24 residues), see Phobius details PF00126: HTH_1" amino acids 4 to 63 (60 residues), 81.8 bits, see alignment E=2.7e-27 PF03466: LysR_substrate" amino acids 88 to 292 (205 residues), 138.7 bits, see alignment E=1.8e-44

Best Hits

Swiss-Prot: 31% identical to TCBR_PSESQ: HTH-type transcriptional regulator TcbR (tcbR) from Pseudomonas sp. (strain P51)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2287)

Predicted SEED Role

"Transcriptional regulator, LysR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K559 at UniProt or InterPro

Protein Sequence (300 amino acids)

>PFLU_RS11235 LysR family transcriptional regulator (Pseudomonas fluorescens SBW25)
MFELTQLRCFTTVATELNFRRAAERLNMTQPPLSRQIQLLEHHLGVELFTRTTRSVALTA
AGRAFFIEAQNLLERAQQAAVTARRFAEGDIGTVNISFVGSAVYEFLPRVIAEARLKQPH
VKIDLAEMNTYQQYEALRARRIDLGIVRAPLLEPGYATECLVREPFVLAVPSSHRLANTE
TVSVHDLDAQPFLMYAHSAYPPFNELLTGLLRSARVAPEYVQWLGSSLTILALVNAGMGL
ALVPRCASSVVFKNVVFRDIDLGEGAQSELHLIWRENNDNPAFAMLLDGIRNAVRDGWAD