Protein Info for PFLU_RS11195 in Pseudomonas fluorescens SBW25

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details transmembrane" amino acids 111 to 133 (23 residues), see Phobius details amino acids 145 to 170 (26 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 266 to 293 (28 residues), see Phobius details amino acids 314 to 337 (24 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 18 to 87 (70 residues), 35.1 bits, see alignment E=1.4e-12 PF00528: BPD_transp_1" amino acids 124 to 345 (222 residues), 140 bits, see alignment E=7.4e-45

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to pfs:PFLU2279)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K551 at UniProt or InterPro

Protein Sequence (345 amino acids)

>PFLU_RS11195 ABC transporter permease (Pseudomonas fluorescens SBW25)
MFVMTASVMGARASNTARRAGTVLVTLLGLLALTFIIGRVMPLDPVLAVVGPDADSSTYD
QVYRAMGLDKPIWTQFGLYLNDLLHGNFGNALLTGHPVLDDIRRVFPATIELATLAILFG
IVIGLPLGVCAASNQGRMGDHVARVITLFGYSTPIFWLGMMGLLVFYAWLGWAGGAGRID
LAYDGMVPDVTGLLLIDTALARDWEAFTSALRHIVLPALILGLNSVAYISRMTRSFMLEQ
LSQEYIITARVKGLSRRQVVWGHAFRNILVQLLTVVALAYGSLLEGAVLIETVFAWPGFG
QYLTSSLMLGDMNAVMGCVLVIGLIFVALNLISDALYKVFDPRTR