Protein Info for PFLU_RS10955 in Pseudomonas fluorescens SBW25

Annotation: peptide-methionine (S)-S-oxide reductase MsrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 11 to 152 (142 residues), 123.8 bits, see alignment E=3.9e-40 PF01625: PMSR" amino acids 12 to 153 (142 residues), 127.9 bits, see alignment E=2.1e-41

Best Hits

Swiss-Prot: 37% identical to MSRA_LEIXX: Peptide methionine sulfoxide reductase MsrA (msrA) from Leifsonia xyli subsp. xyli (strain CTCB07)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 100% identity to pfs:PFLU2228)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.11

Use Curated BLAST to search for 1.8.4.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K934 at UniProt or InterPro

Protein Sequence (155 amino acids)

>PFLU_RS10955 peptide-methionine (S)-S-oxide reductase MsrA (Pseudomonas fluorescens SBW25)
MTDFRQDVIVEQATFGAGCFWRAEAAFRSLPGVLDSRVGFARSVRGESELIEVVQVDFDS
KVISYSRLIEHFWTLHDPTSFDRQGADVGVKYRSALFFGTAQQAQLALVAKQRLDASGQL
GKPVATVIVPLGEFQLADEDQQRYLEKHGASSCSI