Protein Info for PFLU_RS10895 in Pseudomonas fluorescens SBW25

Annotation: LLM class flavin-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03860: FMN-dependent oxidoreductase, nitrilotriacetate monooxygenase family
  • amino acids 10 to 429 (420 residues), 583.8 bits, E=9.2e-180
• PF00296: Bac_luciferase
  • amino acids 21 to 383 (363 residues), 187 bits, E=2.8e-59

Best Hits

Swiss-Prot: 56% identical to YXEK_BACSU: Putative monooxygenase YxeK (yxeK) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2215)

MetaCyc: 56% identical to N-acetyl-S-(2-succino)-L-cysteine monooxygenase monomer (Bacillus subtilis subtilis 168)
1.14.13.M85 [EC: 1.14.13.M85]

Predicted SEED Role

"Nitrilotriacetate monooxygenase component A (EC 1.14.13.-)" (EC 1.14.13.-)

MetaCyc Pathways

• S-(2-succinyl)-L-cysteine degradation (2/4 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Bisphenol A degradation
• Brassinosteroid biosynthesis
• Carotenoid biosynthesis - General
• Cyanoamino acid metabolism
• Flavonoid biosynthesis
• Histidine metabolism
• Isoflavonoid biosynthesis
• Limonene and pinene degradation
• Methane metabolism
• Naphthalene and anthracene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Styrene degradation
• Toluene and xylene degradation
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.13.M85

Sequence Analysis Tools

See C3K8C7 at UniProt or InterPro

Protein Sequence (444 amino acids)

>PFLU_RS10895 LLM class flavin-dependent oxidoreductase (Pseudomonas fluorescens SBW25)
MTRRTDQLKLGAFLANSGHHVAAWRHPLAQADASLDFEHFKHIAQTAERGKFDALFIADV
VALWGHHHDALSRTARAEHFEPLTLMSALAAVTHKIGLIATATTTYNEPYHIARKFASLD
HLSKGRAAWNLVTSVVSDEAWNFGREHHVDHGDRYQRAEEFHDVVKGLWDSWDDDAFTRD
KASGEYFDPTKLHTLNHRGEHFSVRGPLNVARPPQGHPVLVQAGASEPGKQLAARVAELI
FAHAHHQQDAQVFYQDIKARAAALGRNPDHVKILPGVTPFIADTREQAQALFKEFQALID
PVLGLRLLADTLGDDIDLSGHDLDGPLPDTPVGQRGSRRDKVLELARTENLSIRQLYLRL
AGGNPVIGTAEDVADHFETWFQARACDGFNVFFPYFPGAIDVFVDQVIPLLQARGLFRQE
YEGTTLRENLGLPRPDNRFTGERA