Protein Info for PFLU_RS10890 in Pseudomonas fluorescens SBW25

Annotation: stationary-phase survival protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01975: SurE
  • amino acids 23 to 228 (206 residues), 133.8 bits, E=3.4e-43

Best Hits

KEGG orthology group: K03787, 5'-nucleotidase [EC: 3.1.3.5] (inferred from 100% identity to pfs:PFLU2214)

Predicted SEED Role

"5-nucleotidase SurE (EC 3.1.3.5)" in subsystem Folate Biosynthesis (EC 3.1.3.5)

MetaCyc Pathways

• purine nucleotides degradation II (aerobic) (11/11 steps found)
• adenosine nucleotides degradation II (5/5 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• guanosine nucleotides degradation III (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)
• superpathway of purines degradation in plants (14/18 steps found)
• ureide biosynthesis (6/7 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• guanosine nucleotides degradation I (3/4 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (2/3 steps found)
• NAD salvage (plants) (5/11 steps found)
• tunicamycin biosynthesis (2/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5

Sequence Analysis Tools

See C3K8C6 at UniProt or InterPro

Protein Sequence (304 amino acids)

>PFLU_RS10890 stationary-phase survival protein (Pseudomonas fluorescens SBW25)
MKRSTWMLAFACLIAPKAFALNILLSNDDGYQHPNIRALYTQLKAQGHTVKIAAPQSDQS
ARGGAFFFGREVTVGHDTDPAYPDSYYISTSDKGVCQSPECAGKEVQIEISGTPVMALLM
GLDKVLPHPDLVIVGPNPGNNLGAINMASGTFNAASVALQSGIPALAVSTDLKEQDPQRA
AQLVAKLVDTLDRHRQPDGALLPPGLGLNMNLPKGTQIKGVKLTRVGSYVGFEARYSDDL
KQFNLPGKPGIGFQYSPAATAAQQNDEAVWLNKGYLTISPFSGLPESINAGPALQKQLAR
EVKP