Protein Info for PFLU_RS10680 in Pseudomonas fluorescens SBW25

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 207 to 227 (21 residues), see Phobius details amino acids 234 to 257 (24 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2172)

Predicted SEED Role

"FIG00960888: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K7A4 at UniProt or InterPro

Protein Sequence (344 amino acids)

>PFLU_RS10680 hypothetical protein (Pseudomonas fluorescens SBW25)
MVASLPHPVAWLRWILGDISEVAFYKHELASLGLLGGAYLAWWASKHGKTWQGFSISYGT
GLWPWLITSSLLGLLLSNLLWGWSVTAQTWQPTFAAFVSLPAAMVLMFGGGWKVAINGAV
LGALLVTPMCLLIVNFVCVPLGLPVVIGNVVGMAVGSVIAFVLCRRVPLLVRSDYIAPAR
PAPAKPPTYGIAWSIRRVLADFSEAPFFGNELASLGLLAGVLLAYALNPVSPAYGSGLVL
PLLGAQALTSLSGVVIWRKQWIKRGWYPTYVPLVSVVPAAVLTHGGSWTVIASSALLGAL
IAPPLACAIAARVPVHVHPYIGNVTSMALSTLMIVPLVGWLVQA