Protein Info for PFLU_RS10540 in Pseudomonas fluorescens SBW25

Annotation: TerC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 219 to 236 (18 residues), see Phobius details PF03741: TerC" amino acids 19 to 209 (191 residues), 162.1 bits, see alignment E=6.2e-52

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2143)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K6S1 at UniProt or InterPro

Protein Sequence (249 amino acids)

>PFLU_RS10540 TerC family protein (Pseudomonas fluorescens SBW25)
MDYLLQLAASPTAWIALATLIVMEIVLGIDNLIFISILTNKLPEKHRAKARRIGISMALI
LRLGLLSTIAFIVQLTTPVFEVFGQGFSWKDMILIAGGLFLVWKATTEIHHSMDPEPEEK
ASVGNTVAIGFAAAIGQILLLDLVFSIDSIITAVGMTEHLPIMIIAVVTSVIVMLVAAEP
LAKFINDNPTVVMLALGFLIMIGMTLIAEGFGAHVPKGYVYAAMAFSAAIECLNIARRNR
HKRLLAARQ