Protein Info for PFLU_RS10475 in Pseudomonas fluorescens SBW25

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 12 to 43 (32 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 266 to 290 (25 residues), see Phobius details amino acids 310 to 342 (33 residues), see Phobius details PF01594: AI-2E_transport" amino acids 14 to 336 (323 residues), 176.6 bits, see alignment E=3.9e-56

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2129)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K6Q7 at UniProt or InterPro

Protein Sequence (355 amino acids)

>PFLU_RS10475 AI-2E family transporter (Pseudomonas fluorescens SBW25)
MNQTNLQFKTLLLLLGLVTIAFIWILLPFYGAVFWAVILGIIFAPMQRRLQQRFGWNRNF
TSLATLSACLIIAILPVIITSALLVQEGATLYKNVESGKLDVAGYIEQFKNVLPPYFQHL
LDRFGMGNLEGLREKIVKSAMQGSQFFATQAFSFGQGTFDFLVSFFIMLYLLFFLLRDGP
ELVRKVRTAVPLAEPQKRRLQLKFNRVVRATVKGNVLVAVTQGALGGLIFWFLDIPSALL
WAVLMAFLSLLPAVGAGIVWGPVAAYFLLSGSIWQGVVLALFGVFVIGLVDNVLRPILVG
KDTKMPDYLILISTLGGLSVFGLNGFVIGPLVAALFMSSWALFVESKPRVKLPLP