Protein Info for PFLU_RS09690 in Pseudomonas fluorescens SBW25

Annotation: pili assembly chaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR03748: integrating conjugative element protein PilL, PFGI-1 class" amino acids 54 to 156 (103 residues), 146.5 bits, see alignment E=1.3e-47

Best Hits

KEGG orthology group: K02487, type IV pili sensor histidine kinase and response regulator (inferred from 86% identity to pfo:Pfl01_3007)

Predicted SEED Role

"PilL protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (180 amino acids)

>PFLU_RS09690 pili assembly chaperone (Pseudomonas fluorescens SBW25)
MERFFTPVCLLGLLSACTAQIPNTLPTHPEIDGGSNRAQHSRGTAEESHPAELRYGRYTL
VSTEPTAEQRDLLAQIIDVNIPSSLSPLVQDALQYVLQRSGYSLCPVSASVKVLFTRPLP
AAHYRLGPIPLRNALQVLAGPAWQLTTDEVSRSVCFEQQKTDAGVALISPASPRQPEARP