Protein Info for PFLU_RS09225 in Pseudomonas fluorescens SBW25

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 42 to 64 (23 residues), see Phobius details amino acids 76 to 93 (18 residues), see Phobius details amino acids 99 to 123 (25 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 162 to 179 (18 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 368 to 385 (18 residues), see Phobius details PF07690: MFS_1" amino acids 15 to 260 (246 residues), 51.5 bits, see alignment E=7.7e-18 PF00083: Sugar_tr" amino acids 42 to 117 (76 residues), 25.3 bits, see alignment E=7.2e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU1871)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K7N2 at UniProt or InterPro

Protein Sequence (397 amino acids)

>PFLU_RS09225 MFS transporter (Pseudomonas fluorescens SBW25)
MSSPVSHRSSLVFLAITLLTFLAASSAPTPLYHLYQEGLHFSAGMLTLIFGVYALSLLAA
LLTVGSLSDHLGRKPVIFAALVLDMLAMLLFIHEDSVAWLIAARTLQGFATGMATAVLGA
ALLDTDRQQGPLVNSVAPLLGMACGAMGSSLLVEFAPLPTQLIYWTLLALMLLQALYVWR
LPETVGRIPGALASLRPTLHVPPQARRALWLSLPVDVAVWAMGGFYLSLAPSLVRAATGS
TSNLIGGGLVAVLTLSGALMIFTLRNRPADKVLRLGAGLLAIGVTLILTAVHSASLPLFF
IATLIAGSGFGAGFLGALRSVVPLALPHERAGLMSAFYVLSYLAFCLPSLLAGNLIRSFG
LIATTDGYGAVLILLSLGALIALLLQDSARVRATTGG