Protein Info for PFLU_RS09100 in Pseudomonas fluorescens SBW25

Annotation: HAMP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details PF00672: HAMP" amino acids 87 to 137 (51 residues), 34.8 bits, see alignment 2.5e-12 PF00512: HisKA" amino acids 142 to 185 (44 residues), 30.2 bits, see alignment 5.6e-11 PF02518: HATPase_c" amino acids 239 to 344 (106 residues), 86.7 bits, see alignment E=2.2e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU1849)

Predicted SEED Role

"Sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K756 at UniProt or InterPro

Protein Sequence (345 amino acids)

>PFLU_RS09100 HAMP domain-containing protein (Pseudomonas fluorescens SBW25)
MRAPFNTLFGRLFGVLLVAIVLAHALAFFWFHHYGQPPPPPPEQFIEQPDGRLVPLRKEH
HRPWFGGPVVPLTFQFVSLIIAAWYGAKLLSRPIQRLSDAAERLSLDLDSPPLDESGPRE
AQQAASTFNLMQRRIREQVSQRARMLGAVSHDLRTPLSRLKLRLEQIEDTKLQGQMRQDL
DDMIGMLDATLSYLHEQRTSETRHWLDVQALVESMSENAQDQGCDVQFAGSCVPLQVQPM
ALRSCLNNLIDNALRYAGTARIELQDSREALVIRVIDHGPGIAADKREAVFEPFYRLECS
RNRNSGGVGLGMTISKEAAERLGGRLELEETPGGGLTAVMWLPRT