Protein Info for PFLU_RS09055 in Pseudomonas fluorescens SBW25

Annotation: NAD(P)H-dependent glycerol-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02558: ApbA
  • amino acids 7 to 112 (106 residues), 31.5 bits, E=3.3e-11
• PF03807: F420_oxidored
  • amino acids 7 to 108 (102 residues), 37.8 bits, E=6e-13
• PF01210: NAD_Gly3P_dh_N
  • amino acids 7 to 160 (154 residues), 176.6 bits, E=9.5e-56
• PF07479: NAD_Gly3P_dh_C
  • amino acids 180 to 321 (142 residues), 170.4 bits, E=6.6e-54
• PF20618: GPD_NAD_C_bact
  • amino acids 240 to 304 (65 residues), 66.1 bits, E=8.4e-22

Best Hits

Swiss-Prot: 100% identical to GPDA_PSEFS: Glycerol-3-phosphate dehydrogenase [NAD(P)+] (gpsA) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00057, glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC: 1.1.1.94] (inferred from 100% identity to pfs:PFLU1840)

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.94)

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• phosphatidylglycerol biosynthesis I (5/6 steps found)
• phosphatidylglycerol biosynthesis II (5/6 steps found)
• glycerol-3-phosphate shuttle (2/2 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
• CDP-diacylglycerol biosynthesis III (3/5 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• 1,3-propanediol biosynthesis (engineered) (4/9 steps found)
• superpathway of phospholipid biosynthesis II (plants) (9/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.94

Sequence Analysis Tools

See C3K747 at UniProt or InterPro

Protein Sequence (341 amino acids)

>PFLU_RS09055 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase (Pseudomonas fluorescens SBW25)
MTEQRPIAVLGGGSFGTAVANLLAENGHAVRQWMRDPEQAEAIRVHRENPRYLKGIKIHP
AVEPVTDLLETLTACDLCFVALPSSALRSVLAPHAERLAGKLLVSLTKGIEAQTFKLMSE
ILEEIAPQARIGVLSGPNLAREVAEHALTATVVASEDEELCERVQAVLHGRTFRVYASSD
RFGVELGGALKNVYAIIAGMAVALGMGENTKSMLITRALAEMTRFAVNQGANPMTFLGLA
GVGDLIVTCSSPKSRNYQVGFALGQGLSLEDAVTRLGEVAEGVNTLKVLKAKAQEVGVYM
PLVAGLHAILFEGRTLNQVIELLMRAEPKTDVDFISTSGFN