Protein Info for PFLU_RS09005 in Pseudomonas fluorescens SBW25

Annotation: molecular chaperone HtpG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 634 PF13589: HATPase_c_3" amino acids 32 to 153 (122 residues), 36.9 bits, see alignment E=5.5e-13 PF02518: HATPase_c" amino acids 32 to 184 (153 residues), 27.9 bits, see alignment E=4.2e-10 PF00183: HSP90" amino acids 225 to 629 (405 residues), 435.2 bits, see alignment E=6.4e-134

Best Hits

Swiss-Prot: 100% identical to HTPG_PSEFS: Chaperone protein HtpG (htpG) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K04079, molecular chaperone HtpG (inferred from 100% identity to pfs:PFLU1830)

Predicted SEED Role

"Chaperone protein HtpG" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K6N7 at UniProt or InterPro

Protein Sequence (634 amino acids)

>PFLU_RS09005 molecular chaperone HtpG (Pseudomonas fluorescens SBW25)
MSVETQKETLGFQTEVKQLLHLMIHSLYSNKEIFLRELISNASDAVDKLRFEALSKPELL
EGGAELKIRVSFDKDAKTVTLEDNGIGMSREDAITHLGTIAKSGTADFMKNLSGDQKKDS
HLIGQFGVGFYSAFIVADKVEVFSRRAGLDASEGVHWSSKGEGEFEIATVDKADRGTRIV
LHLKDGEDEFADGWRLRNIVKKYSDHIALPIELPKEQAAAEGEETPAQEWEVVNRASALW
TRPRTEIKDEEYQEFYKHIGHDYENPLSWSHNKVEGKLEYSSLLYVPARAPFDLYQREAP
KGLKLYVQRVFVMDQAESFLPLYLRFIKGVVDSNDLSLNVSREILQKDPIIDSMKSALTK
RVLDMLEKLAKNEPEQYKGFWKNFGQVMKEGPAEDFANKEKIAGLLRFASTQGDDGEQVV
SLAEYLARAKEGQDKIYYLTGETYAQVKNSPHLEVFRKKGIEVLLLTDRIDEWLMSYLNE
FDGKSFVDVARGDLDLGNLDSEEEKKEAEEVAKSKEGLVERIKASLGDAVSEVRVSHRLT
DSPAILAIGEQDLGMQMRQILEASGQKVPDSKPIFEFNPAHPLIEKLDGEQSEERFGDLS
HILFDQAALAAGDSLKDPAAYVRRLNKLLVELSV