Protein Info for PFLU_RS08820 in Pseudomonas fluorescens SBW25

Annotation: metalloprotease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 transmembrane" amino acids 476 to 497 (22 residues), see Phobius details PF12388: Peptidase_M57" amino acids 35 to 164 (130 residues), 22.2 bits, see alignment E=2.9e-08 PF01400: Astacin" amino acids 59 to 160 (102 residues), 23.5 bits, see alignment E=1.2e-08 PF13583: Reprolysin_4" amino acids 131 to 196 (66 residues), 22.2 bits, see alignment E=3.1e-08 PF08548: Peptidase_M10_C" amino acids 222 to 428 (207 residues), 223.1 bits, see alignment E=9.6e-70 PF00353: HemolysinCabind" amino acids 306 to 340 (35 residues), 32.3 bits, see alignment 2.3e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU1793)

Predicted SEED Role

"Secreted alkaline metalloproteinase (EC 3.4.24.-), PrtA/B/C/G homolog" in subsystem Protein secretion by ABC-type exporters (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K5M8 at UniProt or InterPro

Protein Sequence (510 amino acids)

>PFLU_RS08820 metalloprotease (Pseudomonas fluorescens SBW25)
MNNYDLRSMSPLNNLPVSDPGPFGAGAGNKPAYTTDQAAKQLSRENLRFHDRNDDSTVDV
HYTVDNSFTQPQQQRVRQALQSWQDVANINFREQSGDSDGTLNVRNNPRSDRGVATSPNR
TTPHTTATLGTQGGNSSAALGSHFSLTAIHEIGHAIGLHHPGDYNGGNPNYQTGATYAGD
THARTVMSYFSEKNQKGHDFKNQSPSAPMMDDIAAAQRLYGANHQTRNTDTTYGFNSNTE
REAFSLKSATDKPVFCVWDGGGIDTMDFSGFAQDQNIDLNAESFSDVGGLKGNVSIAKGC
TIENAMGGAGRDTLSGNDAANRLKGGGGADTLRGGGGADTFVYDKASDSTPDQPDMIEDF
TSGTDKIDVSGALKDAGVRGLVFTDRFTGRAGEAVLKQDANTGQSSLAIDLKGTGTADLL
VKSKGEIKPADVRWDGQAPEVSPLPKPAPAPTPAPVPAPAPTPAPLPDKKQDSTAGVIHI
FVVTLLAIFSQLLSLLTSSSGQASAGKKQP