Protein Info for PFLU_RS08480 in Pseudomonas fluorescens SBW25

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01564: Spermine_synth
  • amino acids 60 to 174 (115 residues), 28.4 bits, E=5.9e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU1724)

Predicted SEED Role

"Spermidine synthase (EC 2.5.1.16)" in subsystem Polyamine Metabolism (EC 2.5.1.16)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (15/17 steps found)
• superpathway of polyamine biosynthesis I (6/8 steps found)
• superpathway of polyamine biosynthesis II (6/8 steps found)
• spermidine biosynthesis I (1/2 steps found)
• L-methionine salvage cycle III (5/11 steps found)
• L-methionine salvage cycle I (bacteria and plants) (4/12 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glutathione metabolism
• Methionine metabolism
• Urea cycle and metabolism of amino groups
• beta-Alanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.16

Sequence Analysis Tools

See C3K6M0 at UniProt or InterPro

Protein Sequence (251 amino acids)

>PFLU_RS08480 hypothetical protein (Pseudomonas fluorescens SBW25)
MTEERVERLLAEVHDDFGMIRVLEVADYRFLEFGDAIEQSCVFTADPSWLEYDYTRAMLI
GALCHEQPESALFLGLGAGTLTQACLKFLPLDDVEAIELRPDVPRLAIEYLGLDDDPRLY
IRVGDALELLDSAESADLIFVDLYTDVGPGVGHLAWTFLENCQKKLNPGGWLVINQWATD
DGKPLGAALLRGLYHRHYWELPVKEGNVILLVPSELDQELDRGALSDRAEALAPRLGYSL
QPLIKAIRPAT