Protein Info for PFLU_RS08235 in Pseudomonas fluorescens SBW25

Annotation: potassium-transporting ATPase subunit KdpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR00681: K+-transporting ATPase, C subunit" amino acids 5 to 181 (177 residues), 187.3 bits, see alignment E=1.4e-59 PF02669: KdpC" amino acids 6 to 179 (174 residues), 200 bits, see alignment E=1.4e-63

Best Hits

Swiss-Prot: 71% identical to KDPC_PSEP1: Potassium-transporting ATPase KdpC subunit (kdpC) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K01548, K+-transporting ATPase ATPase C chain [EC: 3.6.3.12] (inferred from 100% identity to pfs:PFLU1678)

Predicted SEED Role

"Potassium-transporting ATPase C chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K4Y5 at UniProt or InterPro

Protein Sequence (181 amino acids)

>PFLU_RS08235 potassium-transporting ATPase subunit KdpC (Pseudomonas fluorescens SBW25)
MSNIVRPALSLLVLMTLITGVAYPLVVTGVAQVAFPDQANGSLVRDASGKVRGSSLIAQD
FTGDGWFHPRPSAGAFATVSSSASNLGPSNPALATRIFDDASKQLVPSQGPVPLVSLTTS
GSGLDPHLPPQAIAYQLARVAAARNVPVSTLQRLLDEHIESPLVGPPVVNVLALNMALEK
L