Protein Info for PFLU_RS08130 in Pseudomonas fluorescens SBW25

Annotation: flippase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 36 to 58 (23 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 303 to 326 (24 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details amino acids 395 to 416 (22 residues), see Phobius details PF01943: Polysacc_synt" amino acids 5 to 287 (283 residues), 72.7 bits, see alignment E=5.1e-24 PF13440: Polysacc_synt_3" amino acids 35 to 335 (301 residues), 33 bits, see alignment E=5.8e-12 PF14667: Polysacc_synt_C" amino acids 343 to 420 (78 residues), 32.1 bits, see alignment E=1.8e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU1653)

Predicted SEED Role

"Membrane protein involved in the export of O-antigen and teichoic acid"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K718 at UniProt or InterPro

Protein Sequence (427 amino acids)

>PFLU_RS08130 flippase (Pseudomonas fluorescens SBW25)
MSIRNNTVWNLIGTGAPFLLGLITIPYLIKWTGVEMFGVLTLVWILIGYFSLFDFGLGRA
LTQTVAKKIAEEKIDEVSITINLGLFLVVFAGVCGGVLLGAISHMLGAHWLGVSAELQSD
VVISFLIAAAGIPLTTATSGLRGVLEAYQEFGKVNVLRVLLGVANFGAPALTVLILGPEL
KWMVASLVAARVVVFIAHTYLVGQKSSFFWVSPKKHKAEIRQLITFGSWMTLSNVISPLM
VTGDRFVISSMMGASFVAYYTVPFEVLVRFLVIPAALTAAIFPRLSALLVTDMRSAYSLF
RKSVMLVAAVMLVFCATAAFGSNFGMTLWLGTEFSEQSAMLASILAIGILFNSVAQIPHS
VVQAAGNVKGTAIVHLAEFCIYFPILYLAVRNFGLMGAVVVWVIRAFVDMSLMFLLSRKI
FLKQERN