Protein Info for PFLU_RS07055 in Pseudomonas fluorescens SBW25

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 44 to 62 (19 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 341 (330 residues), 124 bits, see alignment E=3.4e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU1430)

Predicted SEED Role

"MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KDH5 at UniProt or InterPro

Protein Sequence (387 amino acids)

>PFLU_RS07055 MFS transporter (Pseudomonas fluorescens SBW25)
MKPRLHCARLALFLCGCAAFLNLYATQSILQTFATQFQISAKAAGWSITVTTLAVAMTAP
FVSRLTGRFEQRTVISMAALLLAVPALMTAYADSFAEVLVWRFVEGMLIPVVFATSVAYI
GDRWSGGTVTEVTSLYVAGTVLGGFAGRFVTGVMTEYVGWREAFECLAVLSLMVGGFIQF
LLPVSRARSTKVQSPFSAVFRKPLLAAYAVGFCVLFSQVAAFTYAGLYLGLPPFNLGPAA
LGTLYMVFLLALIVIPIAGRLSKSRPHAELLSVAALLGISGSALTLVPSLWCIVVGLALS
STGVFLAQAAANAFTAATARDNKASAVGVYLTCYYLGGSCGAIVPALIWERWGWTGCVAL
IITFQILTLLIALNGWKPSEPELIPTP