Protein Info for PFLU_RS07015 in Pseudomonas fluorescens SBW25

Annotation: LysE family translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 40 to 63 (24 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 109 to 134 (26 residues), see Phobius details amino acids 146 to 170 (25 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details PF01810: LysE" amino acids 18 to 200 (183 residues), 77.1 bits, see alignment E=6.6e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU1422)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KDG7 at UniProt or InterPro

Protein Sequence (213 amino acids)

>PFLU_RS07015 LysE family translocator (Pseudomonas fluorescens SBW25)
MTPSLLLAVLSSGFIYGITPGPGVLAVFGIGAARGRRAGAGFLCGHLLGDVVWCSTALIA
IVGAREVGSSAFDVLGVLSGLYLFWLGWRAIRTQRRSGDTPQGAARHPFWHGILFGLTNP
KAYPVAVATFTALLSSRAELLTWSMLPSLIFLSFIGGVLAYAILIGVVGAQRVRTVYQRH
EILITRLCGVMFIGFAINALAHALPGLFGSKPT