Protein Info for PFLU_RS06930 in Pseudomonas fluorescens SBW25

Annotation: TonB-dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 854 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR01785: TonB-dependent heme/hemoglobin receptor family protein" amino acids 116 to 851 (736 residues), 453.6 bits, see alignment E=1.3e-139 TIGR01786: TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein" amino acids 125 to 851 (727 residues), 375.4 bits, see alignment E=5.8e-116 PF07715: Plug" amino acids 129 to 233 (105 residues), 68.9 bits, see alignment E=5e-23 PF00593: TonB_dep_Rec" amino acids 370 to 825 (456 residues), 148.4 bits, see alignment E=6.1e-47

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to pfs:PFLU1405)

Predicted SEED Role

"Putative Ton-B dependent hemine receptor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KCU9 at UniProt or InterPro

Protein Sequence (854 amino acids)

>PFLU_RS06930 TonB-dependent receptor (Pseudomonas fluorescens SBW25)
MFRAPCHASLLLLRPTLIATCLALSLSAQAETFQLPAQALATSLSQVAQQAQIQLLFDEA
LLKNVQAPALNGDFTPEVAIRNLLKNGEFTLIKIGSTYVVRPEEAKTTQSGAIQLDALSV
IGTGNEVDSSTVGRSTLSQADIDRYQPDNIPSLLQTLPGVSMGGSPKPGGQTMNIRGMGD
AEDVPMTVDGAAKSGFERYQQGTIFIEPELIKSIEVEKGPYSPFTGNGGFGGTVNMITKD
ASDLLKDGRNTGAMVKYGYASNTHEQVYTGAVYGRTDDGRMDALAYLTQRDGDDLKLADT
PPDPRNQYPINPKRLPNSAQDVEGQLFKFNAYFTDEHSMGLSYSRAQSQRMTPFSAKSYP
SPPRQSDIDRYGYATAVSRFLADRDTVDTTWSSKYEYHPLDNPLIDLKLSYSQSNTDQTD
ERAANAVIGLATGGRKMDTSYTDRILELRNTSLLTTGPLEHAVTTGVQIRKHKRETESWM
PGATYNTAQYNYGHFQPYFMPHGKVDSNAFYIQDAITLGDLTITPSLRYDHVRNRGEAND
APYYSSPDPRVGHDYSDRTYTGWSPRLAAFWNVTPDVAFFASWNRTWRAPVIDEQYEVQG
PISTRSATSLNLDPERITAITAGNVTNFSGLFTRDDNLQLRTTLFHNRIEDEIMKATGIG
CERQLTVPGSIGSVCSDAASRTNYRNVGGMTIKGVELESYYDSTYLFGSLTYSWATGKRD
NPYTNPWATNLHVWARDIPPAKWVVVLGTKIPSWDAQVGWQGQFVRKTDRVPTDIYPSGL
NSTIGDFIYDQTENPSYDTQGLFANWKPQQAGLKGTEINFTVDNLFNRSYQPALSGEGVY
SEGRNAKISITRFF