Protein Info for PFLU_RS06835 in Pseudomonas fluorescens SBW25

Annotation: aminodeoxychorismate/anthranilate synthase component II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase" amino acids 3 to 189 (187 residues), 207.4 bits, see alignment E=9e-66 PF00117: GATase" amino acids 5 to 188 (184 residues), 171.9 bits, see alignment E=1.2e-54 PF07722: Peptidase_C26" amino acids 70 to 173 (104 residues), 39.5 bits, see alignment E=5.6e-14

Best Hits

Swiss-Prot: 49% identical to PABA_BACSU: Aminodeoxychorismate/anthranilate synthase component 2 (pabA) from Bacillus subtilis (strain 168)

KEGG orthology group: K01658, anthranilate synthase component II [EC: 4.1.3.27] (inferred from 100% identity to pfs:PFLU1385)

MetaCyc: 49% identical to 4-amino-4-deoxychorismate synthase; anthranilate synthase (subunit II) (Bacillus subtilis subtilis 168)
RXN-22440 [EC: 2.6.1.123]

Predicted SEED Role

"Anthranilate synthase, amidotransferase component (EC 4.1.3.27)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Tryptophan synthesis (EC 4.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.27

Use Curated BLAST to search for 2.6.1.123 or 4.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KBN9 at UniProt or InterPro

Protein Sequence (197 amino acids)

>PFLU_RS06835 aminodeoxychorismate/anthranilate synthase component II (Pseudomonas fluorescens SBW25)
MKVFLIDAYDSFVFIISQYLEQLGLETHVERNDVPDLIQRIEAYAPDFCVLGPGPGHPQD
AGYIEVIQHFKGRLPILGVCLGHQAIGLAFGGSVIRADHVMHGKISTIENDGCGVYTHTQ
GRSIKATRYHSLIIDHQCLARQLAVTSTSTDDGYIMGVRHLEYPIEGVQFHPESILTENG
LGIFRSFIEQHCRPSGS