Protein Info for PFLU_RS06690 in Pseudomonas fluorescens SBW25

Annotation: RidA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF14588: YjgF_endoribonc" amino acids 8 to 149 (142 residues), 95.4 bits, see alignment E=3.8e-31 PF01042: Ribonuc_L-PSP" amino acids 21 to 151 (131 residues), 45.5 bits, see alignment E=7.2e-16

Best Hits

Swiss-Prot: 46% identical to TCP17_TRYCR: Protein TCP17 (TCP17) from Trypanosoma cruzi

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU1355)

Predicted SEED Role

"RidA/YER057c/UK114 superfamily, group 2, YoaB-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KAM4 at UniProt or InterPro

Protein Sequence (156 amino acids)

>PFLU_RS06690 RidA family protein (Pseudomonas fluorescens SBW25)
MSDSLRQRVHALGLALPTPSQPIANYINHVVSQNHLFVSGQIPLVDGKPAYVGRLGESIS
DEEGAHAAELAALGLLGQLSDALGDDLSRLVRTVRLGVFIASGADFKQQSVVANGASNLL
VNALGEKGRHVRTAVGVSSLPAGVAVEVDAIFELHP