Protein Info for PFLU_RS06470 in Pseudomonas fluorescens SBW25

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 transmembrane" amino acids 20 to 47 (28 residues), see Phobius details amino acids 65 to 89 (25 residues), see Phobius details amino acids 106 to 117 (12 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 20 to 122 (103 residues), 55.6 bits, see alignment E=3.2e-19 PF00528: BPD_transp_1" amino acids 44 to 227 (184 residues), 61 bits, see alignment E=6.6e-21

Best Hits

Swiss-Prot: 58% identical to HISM_ECOL6: Histidine transport system permease protein HisM (hisM) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K10015, histidine transport system permease protein (inferred from 100% identity to pfs:PFLU1309)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisM (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K715 at UniProt or InterPro

Protein Sequence (236 amino acids)

>PFLU_RS06470 ABC transporter permease (Pseudomonas fluorescens SBW25)
MIELLQEYWRPFLYSDGQHITGLAMTMWLLTAALVIGFVVSIPLSIARVSRNPLVRWPVQ
FYTYLFRGTPLYIQLLICYTGIYSIAAVRAQPVLDAFFRDAMNCTILTFALNTCAYTTEI
FAGSIRSMAHGEVEAAKAYGLSGWKLYAYVIMPSALRRSLPYYSNEVILMLHSTTVAFTA
TIPDILKVARDANSATFMTFQSFGIAALIYLTVTFALVGLFRLAERRWLAFLGPSH