Protein Info for PFLU_RS06170 in Pseudomonas fluorescens SBW25

Annotation: ribosomal RNA small subunit methyltransferase J

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF04445: SAM_MT" amino acids 37 to 254 (218 residues), 296.3 bits, see alignment E=7.1e-93

Best Hits

Swiss-Prot: 100% identical to RSMJ_PSEFS: Ribosomal RNA small subunit methyltransferase J (rsmJ) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU1248)

Predicted SEED Role

"SAM-dependent methyltransferase (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K4Q4 at UniProt or InterPro

Protein Sequence (260 amino acids)

>PFLU_RS06170 ribosomal RNA small subunit methyltransferase J (Pseudomonas fluorescens SBW25)
MSEQPAASRIQVEALGDGFKARAEQWASLLGLPLQLADADFSLQVGEHGLQLQQLGPDAP
GPVRVDFVEGGAAHRRLYGGGSGQMIAKAVGIAQGVRPRVLDATAGLGKDAFVLASLGCE
MSLIERQPLIGALLEDGLARGADDFEVAPIVARMQLLKGNSIDVMRNWEGEPPQVIYLDP
MFPHREKTALVKKEMRLFRPLVGDDPDAPALLAAALALASHRVVVKRPRKAPCIDGPKPS
HALDGKSSRYDIYPKKALKP