Protein Info for PFLU_RS05945 in Pseudomonas fluorescens SBW25

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF13508: Acetyltransf_7" amino acids 56 to 127 (72 residues), 51.3 bits, see alignment E=2.5e-17 PF13673: Acetyltransf_10" amino acids 56 to 132 (77 residues), 57.4 bits, see alignment E=3.1e-19 PF00583: Acetyltransf_1" amino acids 63 to 125 (63 residues), 50.1 bits, see alignment E=6.6e-17

Best Hits

KEGG orthology group: K03827, putative acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to pfs:PFLU1202)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KDR3 at UniProt or InterPro

Protein Sequence (155 amino acids)

>PFLU_RS05945 GNAT family N-acetyltransferase (Pseudomonas fluorescens SBW25)
MRRHSVIHTPKTSDYQKLTEIWESSVRATHDFLPDSYIEHLRHLVLTHYLDTVMLICTKD
SHQRITGFAGVATGKVEMLFIDPKYRGQGLGRQLLRYAIEHMNADELEVNEQNPQALGFY
LKQGFEVIGRTEHDGLGQPYPLLRMRLCQQQQRSG