Protein Info for PFLU_RS05130 in Pseudomonas fluorescens SBW25

Annotation: HAAAP family serine/threonine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 142 to 159 (18 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 209 to 232 (24 residues), see Phobius details amino acids 252 to 273 (22 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 346 to 363 (18 residues), see Phobius details amino acids 369 to 393 (25 residues), see Phobius details amino acids 406 to 427 (22 residues), see Phobius details TIGR00814: serine transporter" amino acids 22 to 417 (396 residues), 547.1 bits, see alignment E=1.3e-168 PF03222: Trp_Tyr_perm" amino acids 34 to 390 (357 residues), 32 bits, see alignment E=3.8e-12

Best Hits

KEGG orthology group: K03837, serine transporter (inferred from 100% identity to pfs:PFLU1034)

Predicted SEED Role

"Serine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions or Threonine anaerobic catabolism gene cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K5Y7 at UniProt or InterPro

Protein Sequence (428 amino acids)

>PFLU_RS05130 HAAAP family serine/threonine permease (Pseudomonas fluorescens SBW25)
MTDVRTPAAENPVSDNTVTTGWTQHDTTWMLGLYGTAIGAGTLFLPINAGVGGFWPLIVL
ALLAFPMTFFAHRGLTRFVLSGKSGDITEVVEEHFGVGAGKLITLLYFFAIFPILLVYSV
ALTNTLGSFMEHQLHMAPPPRAILSLVLILGLMAIVRCGQGVIVKAMSVLVYPFVAALLL
LAVSLVPNWNGAFFASASEGMPLPMFFKTLWLAIPVMVFSFNHSPIISAFAVDQKRVYGP
QAERKSSGILATAHGMMVLTVMFFCFSCVLALSPADLAAAKAQNISILSYLANHFQTPVI
AYAAPLIALVAITKSFLGHYIGASEGFQGLIVKSLRGRNRSMSSKWLERCTALFMVLTCW
AVATFNPSILGMIETMGGPIIACLLFLMPMYAIRRVPSLRQYSGQLSNVFVVVIGLIALS
AIVFSVLP