Protein Info for PFLU_RS05060 in Pseudomonas fluorescens SBW25

Annotation: GIY-YIG nuclease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 91 PF01541: GIY-YIG" amino acids 10 to 80 (71 residues), 53.7 bits, see alignment E=1.1e-18

Best Hits

Swiss-Prot: 52% identical to Y675_VIBC3: UPF0213 protein VC0395_0675/VC395_A0575 (VC0395_0675) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K07461, putative endonuclease (inferred from 100% identity to pfs:PFLU1020)

MetaCyc: 43% identical to DNA damage response nuclease YhbQ (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease I. [EC: 3.1.11.1]

Predicted SEED Role

"FIG00955494: hypothetical protein"

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.1

Use Curated BLAST to search for 3.1.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K5C5 at UniProt or InterPro

Protein Sequence (91 amino acids)

>PFLU_RS05060 GIY-YIG nuclease family protein (Pseudomonas fluorescens SBW25)
MTDIPEPKPWFVYLVRAANGSLYCGISNDPVRRFASHQSGKGARFFLSSPAVALVYTEQC
ASKGEALRQERLIKKLKKSAKECLAASGSLI