Protein Info for PFLU_RS04980 in Pseudomonas fluorescens SBW25

Annotation: type II toxin-antitoxin system MqsA family antitoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 PF15731: MqsA_antitoxin" amino acids 6 to 135 (130 residues), 88.6 bits, see alignment E=2e-29 TIGR03830: putative zinc finger/helix-turn-helix protein, YgiT family" amino acids 6 to 135 (130 residues), 117.6 bits, see alignment E=3e-38 TIGR03831: YgiT-type zinc finger domain" amino acids 6 to 53 (48 residues), 40.7 bits, see alignment E=2.1e-14

Best Hits

KEGG orthology group: K13655, HTH-type transcriptional regulator / antitoxin for MqsR toxin (inferred from 100% identity to pfs:PFLU1004)

Predicted SEED Role

"FIG00958224: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K4N6 at UniProt or InterPro

Protein Sequence (163 amino acids)

>PFLU_RS04980 type II toxin-antitoxin system MqsA family antitoxin (Pseudomonas fluorescens SBW25)
MKVKDCYICGAPRGLTYFEGRSETISIKGMDRRVDELSGWECKVCGDGFWDPDNDSTDRY
DAAKDALTLAARKMIGTEMKRTRRKLHLTQKEAVELLSGGGHNAFSRYERGELLAPKPLV
LLMRLLDRHPHLLADAKILAEGADLRGAFTYTVNDEAQALKVS