Protein Info for PFLU_RS04940 in Pseudomonas fluorescens SBW25
Annotation: molybdopterin converting factor subunit 1
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 48% identical to MOAD_HAEIN: Molybdopterin synthase sulfur carrier subunit (moaD) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
KEGG orthology group: K03636, molybdopterin synthase sulfur carrier subunit (inferred from 100% identity to pfs:PFLU0996)MetaCyc: 49% identical to molybdopterin synthase sulfur carrier subunit (Escherichia coli K-12 substr. MG1655)
RXN-8342 [EC: 2.8.1.12]
Predicted SEED Role
"Molybdenum cofactor biosynthesis protein MoaD" in subsystem Molybdenum cofactor biosynthesis
MetaCyc Pathways
- molybdopterin biosynthesis (4/6 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.8.1.12
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See C3KEA6 at UniProt or InterPro
Protein Sequence (80 amino acids)
>PFLU_RS04940 molybdopterin converting factor subunit 1 (Pseudomonas fluorescens SBW25) MSINVLFFARYAEAVGLDSLEMEGEFATVDAVRLALASDPEFAVLNETSLMCARNEELCG LDEPVQAGDEVAFFPPVTGG