Protein Info for PFLU_RS04655 in Pseudomonas fluorescens SBW25

Annotation: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 TIGR00096: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase" amino acids 14 to 285 (272 residues), 295.9 bits, see alignment E=1.5e-92 PF00590: TP_methylase" amino acids 14 to 211 (198 residues), 109.1 bits, see alignment E=1.5e-35

Best Hits

Swiss-Prot: 80% identical to RSMI_PSEAE: Ribosomal RNA small subunit methyltransferase I (rsmI) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07056, (no description) (inferred from 100% identity to pfs:PFLU0937)

MetaCyc: 57% identical to 16S rRNA 2'-O-ribose C1402 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11637 [EC: 2.1.1.198]

Predicted SEED Role

"rRNA small subunit methyltransferase I" in subsystem Heat shock dnaK gene cluster extended

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.198

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KBY4 at UniProt or InterPro

Protein Sequence (290 amino acids)

>PFLU_RS04655 16S rRNA (cytidine(1402)-2'-O)-methyltransferase (Pseudomonas fluorescens SBW25)
MTAPGPLNSTAGSLFVVATPIGNLDDISARALKVLREVKLIAAEDTRHSQRLMQHFGIST
PLAACHEHNEREEGSRFIVRLLAGDDVALISDAGTPLISDPGYHLVRQARAAGINVVPVP
GACALIAALSAAGLPSDRFIFEGFLPAKAVGRRARLQALKEEPRTLIFYEAPHRILECLQ
DMELVFGGERLALLARELTKTFETLKGLPLEALRGFVEGDSNQQRGECVVLVAGWTAPES
EDAVSSEAMRVLDLLLKEMPLKRAAALAAEITGARKNVLYQVALDKQKAE