Protein Info for PFLU_RS04475 in Pseudomonas fluorescens SBW25

Annotation: histidinol-phosphate transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 TIGR01141: histidinol-phosphate transaminase" amino acids 8 to 349 (342 residues), 302.4 bits, see alignment E=1.8e-94 PF00155: Aminotran_1_2" amino acids 25 to 346 (322 residues), 211.3 bits, see alignment E=1.2e-66

Best Hits

Swiss-Prot: 90% identical to HIS81_PSEPF: Histidinol-phosphate aminotransferase 1 (hisC1) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00817, histidinol-phosphate aminotransferase [EC: 2.6.1.9] (inferred from 100% identity to pfs:PFLU0897)

Predicted SEED Role

"Histidinol-phosphate aminotransferase (EC 2.6.1.9)" in subsystem Histidine Biosynthesis (EC 2.6.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.9

Use Curated BLAST to search for 2.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KAJ6 at UniProt or InterPro

Protein Sequence (350 amino acids)

>PFLU_RS04475 histidinol-phosphate transaminase (Pseudomonas fluorescens SBW25)
MSKFWSPFVKDLVPYVPGEQPKLTKLVKLNTNENPYGPSPKALAAMQAELNDNLRLYPDP
NSDLLKQAVAKYYGIDAGKVFLGNGSDEVLAHIFHGLFQHDLPLLFPDISYSFYPVYCGL
YGIKSDPVPLDEQFQIRVADYAKPNGGIIFPNPNAPTGCVLALDAVEQILKGSPDSVVVV
DEAYIDFGGETAISLVDRYPNLLVTQTLSKSRSLAGLRVGLAVGHPDLIEALERVKNSFN
SYPLDRLAIVGAAAAFEDREYFEKTCRLVIDSRDKLVAQLEEKGFEVLPSAANFIFARHP
EHDAASLAAKLREQGVIVRHFKQARIAQFLRISIGTPEQNQALIDGLGEL