Protein Info for PFLU_RS04370 in Pseudomonas fluorescens SBW25

Annotation: superoxide dismutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00081: Sod_Fe_N
  • amino acids 2 to 89 (88 residues), 115.6 bits, E=1.2e-37
• PF02777: Sod_Fe_C
  • amino acids 96 to 197 (102 residues), 132.7 bits, E=4.8e-43

Best Hits

Swiss-Prot: 81% identical to SODM_PSEPU: Superoxide dismutase [Mn] (sodA) from Pseudomonas putida

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 100% identity to pfs:PFLU0876)

MetaCyc: 57% identical to superoxide dismutase (Mn) (Escherichia coli K-12 substr. MG1655)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Manganese superoxide dismutase (EC 1.15.1.1)" in subsystem Nitric oxide synthase or Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• ethene biosynthesis III (microbes) (6/7 steps found)
• superoxide radicals degradation (2/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

See C3K836 at UniProt or InterPro

Protein Sequence (203 amino acids)

>PFLU_RS04370 superoxide dismutase (Pseudomonas fluorescens SBW25)
MTYTLPALPYAYDALEPHIDAQTMEIHYSKHHQTYINNLNAAVEGTEFAGWPVEKLVSSV
QQLPEKLRAAVINQGGGHANHSLFWAVMSPKGGGKPEGALSKAIDEQLGGFDSFKEAFTK
AALTRFGSGWAWLSVTPQKTLVVESSGNQDSPLMNGNTPILGLDVWEHAYYLLYQNRRPE
YINAFYSVINWPEVADRYQAAVA