Protein Info for PFLU_RS04315 in Pseudomonas fluorescens SBW25

Annotation: rod shape-determining protein MreD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 37 to 62 (26 residues), see Phobius details amino acids 68 to 91 (24 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details PF04093: MreD" amino acids 7 to 149 (143 residues), 109.9 bits, see alignment E=7e-36 TIGR03426: rod shape-determining protein MreD" amino acids 8 to 152 (145 residues), 120 bits, see alignment E=4.5e-39

Best Hits

KEGG orthology group: K03571, rod shape-determining protein MreD (inferred from 100% identity to pfs:PFLU0865)

Predicted SEED Role

"Rod shape-determining protein MreD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K7G2 at UniProt or InterPro

Protein Sequence (162 amino acids)

>PFLU_RS04315 rod shape-determining protein MreD (Pseudomonas fluorescens SBW25)
MAGTHSRNGWIVWLTFAIGLLLSVSPLPQFMEILRPLWLALLLAFWSLNLPHKVGMVTAM
FLGLAEDVLYGTLLGQNALILTLITFLVLSLQQRLRMFPMWQQCLVILVIFGLAQLVQLW
LSALTGNRQPTLALVLPALVSALLWPWISFGLRGLRRRYKIN