Protein Info for PFLU_RS03645 in Pseudomonas fluorescens SBW25

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF14559: TPR_19" amino acids 235 to 293 (59 residues), 35 bits, see alignment 1.1e-11 amino acids 473 to 529 (57 residues), 31.6 bits, see alignment 1.3e-10 PF13432: TPR_16" amino acids 263 to 313 (51 residues), 18.1 bits, see alignment 2.4e-06 amino acids 303 to 346 (44 residues), 19.2 bits, see alignment 1.1e-06 amino acids 358 to 408 (51 residues), 17.8 bits, see alignment 2.9e-06 amino acids 473 to 525 (53 residues), 21.9 bits, see alignment 1.6e-07 PF13374: TPR_10" amino acids 495 to 521 (27 residues), 16.7 bits, see alignment (E = 4.6e-06) PF13174: TPR_6" amino acids 531 to 558 (28 residues), 12.6 bits, see alignment (E = 0.00014)

Best Hits

Swiss-Prot: 69% identical to Y4667_PSEAE: TPR repeat-containing protein PA4667 (PA4667) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU0735)

Predicted SEED Role

"FIG140336: TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KDC4 at UniProt or InterPro

Protein Sequence (574 amino acids)

>PFLU_RS03645 tetratricopeptide repeat protein (Pseudomonas fluorescens SBW25)
MNRSSALLLAFVFLSGCQAMAPVSPDGTPPVEDSTPAPEKPKVYSSFSEETVYSLLTAEL
AGQRNRFDIALDNYVTQAINTQDPGISERAFRIAEYLGADQAALDTSMIWAKNAPDDLEA
QRAAAIQLARAGRYDDSMVYMEKVLQGKGDTHFDFLALSAADTDQDTRNGLMKSFDRLLQ
KHPKNSQLVFGKALLLQQDDEADAALKLLEQNPPEEGEIAPILLRARLLQNLNRGKEAIP
LLEKNIKKYPDDKRLRLTYARMLVEQDRMEDAKVQFANLVQQYPDDDELRYSLALVCLEA
KAWDEAKGYLEELIQRESHVDSAHLNLGRIAEERNDPQAALLEYAQVGPGNDYLPAQLRQ
ADILMSNGRTDEAEKRLAAARDAEPDYAIQLYLIQAETLSANKQGERAWKLLQQALLQFP
DDLNLLYTRAMQAEKRNDLAQMEKDLRLIIKRDPDNAMALNALGYTLSDRTTRYAEAKVL
IEQAHKLNPEDPAVLDSLGWVNYRLGNLDEAERLLRLALERFPDQEVAAHLGEVLWANGK
QREARQIWEKFLKEQPESPILRGTIKRLTGSETL