Protein Info for PFLU_RS03560 in Pseudomonas fluorescens SBW25

Annotation: EscT/YscT/HrcT family type III secretion system export apparatus protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 64 to 90 (27 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details amino acids 183 to 206 (24 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details TIGR01401: type III secretion apparatus protein SpaR/YscT/HrcT" amino acids 6 to 249 (244 residues), 213 bits, see alignment E=2.6e-67 PF01311: Bac_export_1" amino acids 10 to 242 (233 residues), 124.4 bits, see alignment E=2.8e-40

Best Hits

KEGG orthology group: K03228, type III secretion protein SctT (inferred from 100% identity to pfs:PFLU0717)

Predicted SEED Role

"Type III secretion inner membrane protein (YscT,HrcT,SpaR,EscT,EpaR1,homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KCQ6 at UniProt or InterPro

Protein Sequence (262 amino acids)

>PFLU_RS03560 EscT/YscT/HrcT family type III secretion system export apparatus protein (Pseudomonas fluorescens SBW25)
MLLYLEYLPSLVIGMARIYPCGILVAAFCFQHIRGMPRHTLVMVLALMPAPGIYAALAGQ
DYSAILLGALVLKEVALGVLLGVLLAMPFWMFESVGALLDNQRGALAGGQLNPSLGPDAT
PIGHLFKQLAIFLLMVSLGLGTLTQVIWDSYLIWPPTAWFPLPAANGMSVFIDLLGDTFT
HMLLYAAPFIAVLLLLEFGIALLGVYSQQLQVSTLAPPVKSLAGIGILLLYFALLQDLIV
GRMSLLGDLKHSLGLLIKVAIP