Protein Info for PFLU_RS03460 in Pseudomonas fluorescens SBW25

Annotation: TolC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF02321: OEP" amino acids 29 to 203 (175 residues), 86.3 bits, see alignment E=1.2e-28 amino acids 232 to 401 (170 residues), 99.1 bits, see alignment E=1.4e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU0697)

MetaCyc: 61% identical to cobalt-zinc-cadmium resistance protein (Pseudomonas putida KT2440)
RXN1G01-61; TRANS-RXN0-200; TRANS-RXN0-244

Predicted SEED Role

"Heavy metal RND efflux outer membrane protein, CzcC family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KBV9 at UniProt or InterPro

Protein Sequence (407 amino acids)

>PFLU_RS03460 TolC family protein (Pseudomonas fluorescens SBW25)
MPIRARTFLWSIVVFLATAQGVGAQTLTLDAALQTAFANNPDLAAAQWEIDIAQGGRQQA
GLIPNPVASWDAEDTRRNSRTTTVKLSQTLELGGKRGARIDVATLAQNAAALTLEQRRNT
LRAEVIDNYYGALRAQERLDLAQRSMAVAERGLAVANGRVTAGKTSPVEATRAQVQLSEM
RLELNRAQIGLTDAYRRLAASTGNAVPDFQVVATHTQSTPALPPATQLLAHLEQTAELRL
AELNILQNEASVGLEKAQRIPDLDVSIGSQYDASVRERVNLVGVSMPIPLFNRNQGNVLA
ATRRADQARDLRNAAELRLRTETRHALDLWQTANTEVRAFNQQILPAAQEAVDSATRGFE
MGKFSFLDVLDAQRTLIAARTQYLTATAQATDAWVRIERIYGDLARF