Protein Info for PFLU_RS03455 in Pseudomonas fluorescens SBW25

Annotation: cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 17 to 42 (26 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 80 to 104 (25 residues), see Phobius details amino acids 116 to 139 (24 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 15 to 287 (273 residues), 293.1 bits, see alignment E=1e-91 PF01545: Cation_efflux" amino acids 18 to 209 (192 residues), 146.6 bits, see alignment E=4.2e-47

Best Hits

Swiss-Prot: 64% identical to CZCD_CUPMC: Metal cation efflux system protein CzcD (czcD) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 100% identity to pfs:PFLU0696)

MetaCyc: 40% identical to Zn2+/Cd2+/Ni2+/Cu2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-200

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KBV8 at UniProt or InterPro

Protein Sequence (301 amino acids)

>PFLU_RS03455 cation transporter (Pseudomonas fluorescens SBW25)
MSAGHNHAKVRAGHERLLWLALGLTGSFMVAEVIGAFITGSLALLSDAAHMMTDALALGI
SLVAIQVAKRAADRKRTFGYARFEILAAAFNALLLFVVAFYILYEAYQRLQAPAEIQSTG
MLVIAVLGLIVNLISMRLLSAASGESLNVKGAYLEVWSDMLGSIGVIIAALVILYTGWGW
VDSLVAAAIGFWVLPRTWTLLKESMNVLLQGVPDGIDIEQVEQAIRGVRGVKDVHDLHIW
ALTSGKNVLSTHLVADSALGTEQQILVQVTELLHEKFDISHATIQVEGAGFAHDEHDEVH
A