Protein Info for PFLU_RS03455 in Pseudomonas fluorescens SBW25
Annotation: cation transporter
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 64% identical to CZCD_CUPMC: Metal cation efflux system protein CzcD (czcD) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 100% identity to pfs:PFLU0696)MetaCyc: 40% identical to Zn2+/Cd2+/Ni2+/Cu2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-200
Predicted SEED Role
"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See C3KBV8 at UniProt or InterPro
Protein Sequence (301 amino acids)
>PFLU_RS03455 cation transporter (Pseudomonas fluorescens SBW25) MSAGHNHAKVRAGHERLLWLALGLTGSFMVAEVIGAFITGSLALLSDAAHMMTDALALGI SLVAIQVAKRAADRKRTFGYARFEILAAAFNALLLFVVAFYILYEAYQRLQAPAEIQSTG MLVIAVLGLIVNLISMRLLSAASGESLNVKGAYLEVWSDMLGSIGVIIAALVILYTGWGW VDSLVAAAIGFWVLPRTWTLLKESMNVLLQGVPDGIDIEQVEQAIRGVRGVKDVHDLHIW ALTSGKNVLSTHLVADSALGTEQQILVQVTELLHEKFDISHATIQVEGAGFAHDEHDEVH A