Protein Info for PFLU_RS03315 in Pseudomonas fluorescens SBW25

Annotation: purine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 24 to 46 (23 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details amino acids 363 to 384 (22 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details amino acids 423 to 442 (20 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 23 to 440 (418 residues), 367.1 bits, see alignment E=1.2e-113 PF00860: Xan_ur_permease" amino acids 25 to 411 (387 residues), 303.3 bits, see alignment E=1.1e-94 TIGR03173: xanthine permease" amino acids 28 to 443 (416 residues), 419.8 bits, see alignment E=1e-129

Best Hits

Swiss-Prot: 46% identical to XANQ_ECOLI: Xanthine permease XanQ (xanQ) from Escherichia coli (strain K12)

KEGG orthology group: K03458, nucleobase:cation symporter-2, NCS2 family (inferred from 100% identity to pfs:PFLU0673)

MetaCyc: 46% identical to xanthine:H+ symporter XanQ (Escherichia coli K-12 substr. MG1655)
RXN-5076

Predicted SEED Role

"Xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KAI9 at UniProt or InterPro

Protein Sequence (464 amino acids)

>PFLU_RS03315 purine permease (Pseudomonas fluorescens SBW25)
MPPETSSPSDLIYGLNDRPKPAPAFLAALQHVLAAFVGIITPPLIIGSTLGLTAHLPYLI
SMALMVSGVGTFIQARRPFGIGAGMICLQGTSFAFLGAVLSAGFLVKQRGGSPEDIMAMI
FGVCFFGAAVQIVLSQFIGQLRRVITPLVTGIVITLIGISLIKVGITDLGGGFNAPDFGA
PTNLALGLFVVLTIILLNRSNTPWVRLSAIIIGLALGSLAAWFSGKLVPQALPDLPLVSL
PIPFRFGFNFDWSAFLPIALIYLISSIETVGDLTANCMIARQPISGPSYISRLKGGVLGD
GVSCMIAATFSAFPNTTFAQNNGVIQLTGVASRYVGLYIGVVLFGLGLFPLIGAVLQQIP
KPVLGGATLVMFGSVAAAGVRILAQAPLDRRSMLIIATSFGVGLGIAAQPNLLHLMPMLV
QNLFDSAITSGGLTAIVLCLLLPEAKAARADANHTTESDTLEPL