Protein Info for PFLU_RS03115 in Pseudomonas fluorescens SBW25

Annotation: methyltransferase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13489: Methyltransf_23
  • amino acids 30 to 159 (130 residues), 55.9 bits, E=1.4e-18
• PF05175: MTS
  • amino acids 34 to 113 (80 residues), 23.3 bits, E=1.3e-08
• PF13847: Methyltransf_31
  • amino acids 41 to 151 (111 residues), 44.5 bits, E=4.3e-15
• PF13649: Methyltransf_25
  • amino acids 45 to 138 (94 residues), 52.6 bits, E=1.9e-17
• PF08242: Methyltransf_12
  • amino acids 46 to 140 (95 residues), 55.3 bits, E=2.7e-18
• PF08241: Methyltransf_11
  • amino acids 46 to 141 (96 residues), 53.8 bits, E=7.8e-18

Best Hits

KEGG orthology group: K06219, S-adenosylmethionine-dependent methyltransferase (inferred from 100% identity to pfs:PFLU0633)

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (10/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (6/8 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (4/9 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (3/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (3/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (3/8 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (3/9 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (4/11 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.64

Use Curated BLAST to search for 2.1.1.64

Sequence Analysis Tools

See C3K7E7 at UniProt or InterPro

Protein Sequence (249 amino acids)

>PFLU_RS03115 methyltransferase domain-containing protein (Pseudomonas fluorescens SBW25)
MSDRHFDQLATRFAEKIYGGAKGAIRLAVLQADLTEALPKRPLRVLDIGAGLGHMSLWLA
EQGHAVTLAEPAEPMLEGARQRFAEAGQTATFIHAPWQALLGQLTEPYDVVLCHAVLEWL
AEPHAILPVLHQLTVPGGWLSLAFYNRDALIYRNLLKGHFRKMRKNDMAGEKQSLTPQQP
LDPRELAAQLVDLWQVESQSGVRVFHDYMPVEFQARADLQDLLEMELAHRRHPSFAGLGR
YLHWICRPV