Protein Info for PFLU_RS02805 in Pseudomonas fluorescens SBW25

Annotation: bacterioferritin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF00210: Ferritin" amino acids 38 to 175 (138 residues), 94.7 bits, see alignment E=5e-31 PF02915: Rubrerythrin" amino acids 40 to 170 (131 residues), 29.3 bits, see alignment E=1e-10

Best Hits

KEGG orthology group: K03594, bacterioferritin (inferred from 100% identity to pfs:PFLU0568)

Predicted SEED Role

"Bacterioferritin" in subsystem Iron acquisition in Vibrio

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K591 at UniProt or InterPro

Protein Sequence (176 amino acids)

>PFLU_RS02805 bacterioferritin (Pseudomonas fluorescens SBW25)
MTEANLTDVATLRSRARQNVENGAVTEGYDADREEIIRLLNASLATELVCVLRYKRHYFM
ASGIKAAVAAQEFLEHATQEAEHADKLAERIVQLGGEPEFNPDLLSKNSHAQYVAGKDLK
EMVYEDLVAERIAVDSYREIIQYIGDKDPTTRRLFEEILAQEEEHADDMADILESL