Protein Info for PFLU_RS02570 in Pseudomonas fluorescens SBW25

Annotation: RNA chaperone Hfq

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 86 TIGR02383: RNA chaperone Hfq" amino acids 6 to 64 (59 residues), 99.6 bits, see alignment E=3.3e-33 PF17209: Hfq" amino acids 7 to 68 (62 residues), 100.6 bits, see alignment E=1.5e-33

Best Hits

Swiss-Prot: 100% identical to HFQ_PSEFS: RNA-binding protein Hfq (hfq) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K03666, host factor-I protein (inferred from 100% identity to pfs:PFLU0520)

Predicted SEED Role

"RNA-binding protein Hfq" in subsystem Hfl operon or Polyadenylation bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KDW3 at UniProt or InterPro

Protein Sequence (86 amino acids)

>PFLU_RS02570 RNA chaperone Hfq (Pseudomonas fluorescens SBW25)
MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAIS
TVVPVRPIRLPSAAGDDAADAEPGNA