Protein Info for PFLU_RS02405 in Pseudomonas fluorescens SBW25

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 PF01266: DAO" amino acids 8 to 316 (309 residues), 68.1 bits, see alignment E=2.1e-22 PF00890: FAD_binding_2" amino acids 8 to 83 (76 residues), 29.6 bits, see alignment E=8.4e-11 PF13450: NAD_binding_8" amino acids 11 to 50 (40 residues), 22.9 bits, see alignment 1.7e-08

Best Hits

Swiss-Prot: 76% identical to Y4991_PSEAE: Probable FAD-dependent oxidoreductase PA4991 (PA4991) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU0487)

Predicted SEED Role

"Oxidoreductase, FAD-binding"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KDK8 at UniProt or InterPro

Protein Sequence (391 amino acids)

>PFLU_RS02405 FAD-dependent oxidoreductase (Pseudomonas fluorescens SBW25)
MPSVISTDVLIVGAGVAGLWLNARLRRQGFSTVVVESATLGGGQSVKSQGIIHGGAKYAL
HGALTGASEAIADMPRRWREALAGSGELDLSGVRLLSEAHYLWSPGTLAGNLTSFFASKA
VRGRVDQVKGDDLPLALQDRRFKGKVYRLAELVIDVPSLIDRLAQLAGDGLLAGQHIEPL
REGDALVGLKVDGREIRAQRIVLSAGAGTADLLSALGLSQPAMQTRPLHMIIAKGPGLKP
LYAHCLGGGTKPRITVTTHPAADGNWVWYMGGDIAEADGVARTPQEQIATAQKELAQLLP
WIDMSQTQWATLRVDRAEPLQSGLSRPDNAFLAEQDRLLVGWPTKLALAPDFADRVIGSL
ERDGIRPSTSEPLPDLPKPAIGVPAWEQLLP